McDonnell Genome Institute

Washington University

Transcript

lnc-SPINT2-10:1

Chromosome

chr19

Gene Name

lnc-SPINT2-10

Start

37932345

CPC Label

noncoding

End

38081448

Cancer

CCRC

Strand

+

Peptide

LAGVFLR

Modified Peptide

Peptide Length

7

ORF Length

85

Open Reading Frame (ORF)

LAGVFLRLLNKSLLGAGTAGSRFRIPGTHSGLGAGTTEVGLESQGRWPRPGRTRDRRSPPGAPLTATCPLCDQSRVRGVFQMHSL

Conservation Score

1

PhyloCSF Frame 1

2.123

No. of Spectra

6

CPC Coding Probability

0.0107052

PhyloCSF Frame 2 

-1.332

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-1.97

CNTI Score

-0.308888635