McDonnell Genome Institute

Washington University

Transcript

lnc-SPIN1-1:4

Chromosome

chr9

Gene Name

lnc-SPIN1-1

Start

88177694

CPC Label

noncoding

End

88179713

Cancer

OSCC

Strand

+

Peptide

GVECSLGILEK

Modified Peptide

n[145]GVECSLGILEK

Peptide Length

11

ORF Length

91

Open Reading Frame (ORF)

LPASSSQSAGITGVSHRAQPGCFFNKGVECSLGILEKEGISGTPPRSCYCLLSPLFGFTWKSHGLGGCRKHSCDARSMALVSAGVCSLKTL

Conservation Score

0.998

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.054351

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4896

PhyloCSF Frame 3

0

CNTI Score

-0.377033238