McDonnell Genome Institute

Washington University

Transcript

lnc-SPHK1-1:1

Chromosome

chr17

Gene Name

lnc-SPHK1-1

Start

76345760

CPC Label

noncoding

End

76346081

Cancer

EOGC

Strand

+

Peptide

RSVRLSAKPAPPSK

Modified Peptide

n[145]RSVRLSAKPAPPSK

Peptide Length

14

ORF Length

42

Open Reading Frame (ORF)

MPKRKAEGDAKGDEAKVKDEPQRRSVRLSAKPAPPSKARAQA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0576089

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5716

PhyloCSF Frame 3

0

CNTI Score

-0.353524648