McDonnell Genome Institute

Washington University

Transcript

lnc-SPG7-3:1

Chromosome

chr16

Gene Name

lnc-SPG7-3

Start

89458869

CPC Label

noncoding

End

89459437

Cancer

BRCA-Luminal A

Strand

+

Peptide

TQIHSGELFK

Modified Peptide

n[145]TQIHSGELFK

Peptide Length

10

ORF Length

52

Open Reading Frame (ORF)

LSSGKLLCDERTQIHSGELFKNYTKQGKTVLDEITIHAFIHMGNGSDNGCQC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0124838

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

0

CNTI Score

-0.428390039