McDonnell Genome Institute

Washington University

Transcript

lnc-SPERT-3:1

Chromosome

chr13

Gene Name

lnc-SPERT-3

Start

45671844

CPC Label

noncoding

End

45672391

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

ASWSNLSMDEK

Modified Peptide

n[145]ASWSNLSM[147]DEK

Peptide Length

11

ORF Length

104

Open Reading Frame (ORF)

LYLLKQSKANHKEWLLTPLPDVAYLSPLSASQEDLKEKEKASWSNLSMDEKVELCCIQFNRSFSGINRGMKKWKMVVGTAMFFGFTALVLIREKHCVWSHPTRL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0926019

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

0

CNTI Score

-0.336950448