McDonnell Genome Institute

Washington University

Transcript

lnc-SPEN-3:1

Chromosome

chr1

Gene Name

lnc-SPEN-3

Start

15835166

CPC Label

noncoding

End

15836877

Cancer

LUAD

Strand

+

Peptide

GALGFFR

Modified Peptide

n[230]GALGFFR

Peptide Length

7

ORF Length

76

Open Reading Frame (ORF)

LLGPWLEGWRCRGALGFFRFLSNACFLALPTPQRPFGSIFPETSLRNSAKSIQFRHCFPLRACARRQAESLWRAGV

Conservation Score

1

PhyloCSF Frame 1

-3.627

No. of Spectra

24

CPC Coding Probability

0.0735757

PhyloCSF Frame 2 

-0.793

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

-2.746

CNTI Score

-0.311006863