McDonnell Genome Institute

Washington University

Transcript

lnc-SPCS2-3:4

Chromosome

chr11

Gene Name

lnc-SPCS2-3

Start

74913592

CPC Label

noncoding

End

74919811

Cancer

BRCA-Luminal B

Strand

+

Peptide

MEPDWLMEK

Modified Peptide

n[145]M[147]EPDWLMEK

Peptide Length

9

ORF Length

86

Open Reading Frame (ORF)

LDLASRKSCKHPRCLSKIPVCYRMEPDWLMEKAYLRMKPGPGRMAPVKKGGKKKKGRSAINEVVTREYTINIHKCIHGVGFKKHAP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0745536

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9099

PhyloCSF Frame 3

0

CNTI Score

-0.318811747