McDonnell Genome Institute

Washington University

Transcript

lnc-SPCS2-3:1

Chromosome

chr11

Gene Name

lnc-SPCS2-3

Start

74876035

CPC Label

noncoding

End

74919948

Cancer

EOGC

Strand

+

Peptide

LCTSVTYVPVTTFK

Modified Peptide

n[145]LCTSVTYVPVTTFK

Peptide Length

14

ORF Length

57

Open Reading Frame (ORF)

MCTTDTRLNKAVWAKGIRNVPCRIHVQLSREYNEDEDSPNKLCTSVTYVPVTTFKNL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.110157

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.322596741