McDonnell Genome Institute

Washington University

Transcript

lnc-SPCS2-1:1

Chromosome

chr11

Gene Name

lnc-SPCS2-1

Start

74980546

CPC Label

noncoding

End

74984043

Cancer

OSCC

Strand

+

Peptide

LQSSVTPPQLWMALK

Modified Peptide

n[145]LQSSVTPPQLWM[147]ALK

Peptide Length

15

ORF Length

73

Open Reading Frame (ORF)

LQSSVTPPQLWMALKSASIHWPGWLWVIELLFLFVGQIGVSAITNTSHCDWINVSDRVQGQYRNLRMPLGFLR

Conservation Score

0.971

PhyloCSF Frame 1

-4.771

No. of Spectra

2

CPC Coding Probability

0.291574

PhyloCSF Frame 2 

-4.648

CNTI Index

noncoding

Max Probability

0.8759

PhyloCSF Frame 3

-5

CNTI Score

-0.395201145