McDonnell Genome Institute

Washington University

Transcript

lnc-SPC25-3:1

Chromosome

chr2

Gene Name

lnc-SPC25-3

Start

168231920

CPC Label

noncoding

End

168232220

Cancer

OV

Strand

-

Peptide

RIEMAAK

Modified Peptide

n[145]RIEMAAK

Peptide Length

7

ORF Length

56

Open Reading Frame (ORF)

LCASLHSGDVMSVTVDLTRGTVWSLEVLESLMPIIVRSAPSRRIEMAAKDCQFEEL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0606337

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8364

PhyloCSF Frame 3

0

CNTI Score

-0.445030408