McDonnell Genome Institute

Washington University

Transcript

lnc-SPC24-1:1

Chromosome

chr19

Gene Name

lnc-SPC24-1

Start

11088239

CPC Label

noncoding

End

11089297

Cancer

OV

Strand

-

Peptide

LSLFGDSWGCQRPLAK

Modified Peptide

n[145]LSLFGDSWGCQRPLAK

Peptide Length

16

ORF Length

55

Open Reading Frame (ORF)

LSLFGDSWGCQRPLAKKAHVRNLPEPHTGLGSLGGSPRNKLDFSGILQTDFGRQC

Conservation Score

0.052

PhyloCSF Frame 1

-3.486

No. of Spectra

146

CPC Coding Probability

0.0103812

PhyloCSF Frame 2 

-4.243

CNTI Index

noncoding

Max Probability

0.9607

PhyloCSF Frame 3

-4.582

CNTI Score

-0.466367589