McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA9-2:1

Chromosome

chr5

Gene Name

lnc-SPATA9-2

Start

95610376

CPC Label

noncoding

End

95620077

Cancer

OV

Strand

-

Peptide

LILPQWQMCFALYDK

Modified Peptide

n[145]LILPQWQMCFALYDK

Peptide Length

15

ORF Length

36

Open Reading Frame (ORF)

LILPQWQMCFALYDKKSWVLCLSSRGSHSLSVHPSH

Conservation Score

0.25

PhyloCSF Frame 1

-5.215

No. of Spectra

10

CPC Coding Probability

0.172759

PhyloCSF Frame 2 

-5.205

CNTI Index

noncoding

Max Probability

0.9456

PhyloCSF Frame 3

-4.897

CNTI Score

-0.387976961