McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA9-1:1

Chromosome

chr5

Gene Name

lnc-SPATA9-1

Start

95701248

CPC Label

noncoding

End

95732295

Cancer

OSCC

Strand

-

Peptide

LVTYLHDGINYK

Modified Peptide

n[145]LVTYLHDGINYK

Peptide Length

12

ORF Length

70

Open Reading Frame (ORF)

LVTYLHDGINYKDHRRATVTKPVSEYGSKKSYNSLNRTCIRQHYLEGRYFQGSHLCSRSMCTVLRASSHP

Conservation Score

0.166

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.24886

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

0

CNTI Score

-0.328298074