McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA6-4:1

Chromosome

chr1

Gene Name

lnc-SPATA6-4

Start

48227887

CPC Label

noncoding

End

48229561

Cancer

CCRC

Strand

-

Peptide

GAASHPEAVLCCGRPPNR

Modified Peptide

GAASHPEAVLCCGRPPNR

Peptide Length

18

ORF Length

86

Open Reading Frame (ORF)

LDPLAPKSLLQILRHCDHTCCDVHRDEDPAKGQEQPGCLGEWGEEEGIQVLDVDRGAASHPEAVLCCGRPPNREIRDLGPDPSPPV

Conservation Score

1

PhyloCSF Frame 1

-3.333

No. of Spectra

1

CPC Coding Probability

0.0487424

PhyloCSF Frame 2 

12.149

CNTI Index

noncoding

Max Probability

0.9014

PhyloCSF Frame 3

0

CNTI Score

-0.318722539