McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA32-4:5

Chromosome

chr17

Gene Name

lnc-SPATA32-4

Start

45247266

CPC Label

noncoding

End

45247843

Cancer

OSCC

Strand

-

Peptide

VAAAGMEPTR

Modified Peptide

n[145]VAAAGMEPTR

Peptide Length

10

ORF Length

104

Open Reading Frame (ORF)

LAGGGEGQARSGGRPGRNGDPAGGDGGGTRGDGYWASHESLRPLEAGSLAANSSEEAALLPGARWFAEACYEELVQVKRLLSGNRLRVAAAGMEPTRIFCKHLY

Conservation Score

1

PhyloCSF Frame 1

-3.385

No. of Spectra

2

CPC Coding Probability

0.158844

PhyloCSF Frame 2 

2.441

CNTI Index

noncoding

Max Probability

0.864

PhyloCSF Frame 3

-3.122

CNTI Score

-0.31863562