McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA32-4:4

Chromosome

chr17

Gene Name

lnc-SPATA32-4

Start

45245185

CPC Label

noncoding

End

45248339

Cancer

OV

Strand

-

Peptide

GAHQRPLQLGAGALAAQTAR

Modified Peptide

n[145]GAHQRPLQLGAGALAAQTAR

Peptide Length

20

ORF Length

80

Open Reading Frame (ORF)

LRLSPGCGGWGALPRGARLLPRGAHQRPLQLGAGALAAQTARSRHPPQVRAARTLRFLTWRGWRSRNAGHEAQPRAPASA

Conservation Score

1

PhyloCSF Frame 1

-2.383

No. of Spectra

2

CPC Coding Probability

0.103381

PhyloCSF Frame 2 

-1.759

CNTI Index

noncoding

Max Probability

0.7253

PhyloCSF Frame 3

-2.205

CNTI Score

-0.308889822