McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA32-2:16

Chromosome

chr17

Gene Name

lnc-SPATA32-2

Start

45218924

CPC Label

noncoding

End

45221105

Cancer

PRAD

Strand

-

Peptide

KNLDTVTAR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

57

Open Reading Frame (ORF)

LGPPRWSQGGVGGCGKEDESQPQGWKRSGHRRGGKKNLDTVTARDLGGPLTLENNNL

Conservation Score

0.978

PhyloCSF Frame 1

-2.576

No. of Spectra

4

CPC Coding Probability

0.0457572

PhyloCSF Frame 2 

-2.52

CNTI Index

noncoding

Max Probability

0.9939

PhyloCSF Frame 3

-2.586

CNTI Score

-0.381147785