McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA32-2:12

Chromosome

chr17

Gene Name

lnc-SPATA32-2

Start

45212248

CPC Label

noncoding

End

45221765

Cancer

OV

Strand

-

Peptide

KNGDMILLNCFECSIQFYVK

Modified Peptide

n[145]KNGDM[147]ILLNCFECSIQFYVK

Peptide Length

20

ORF Length

72

Open Reading Frame (ORF)

MSELGSECSHKLPEPLFSSLKKKKNGDMILLNCFECSIQFYVKHLAETFISSNKVDYICSEKLLCTKQLEML

Conservation Score

0.861

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.126302

PhyloCSF Frame 2 

-4.113

CNTI Index

noncoding

Max Probability

0.8295

PhyloCSF Frame 3

-4.236

CNTI Score

-0.27635936