McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA32-2:1

Chromosome

chr17

Gene Name

lnc-SPATA32-2

Start

45214009

CPC Label

noncoding

End

45222849

Cancer

CCRC

Strand

-

Peptide

GALGSAAR

Modified Peptide

n[230]GALGSAAR

Peptide Length

8

ORF Length

379

Open Reading Frame (ORF)

LKKRPLSLPPPGGGSCRTGDLQAAPESPGAGTRAQPLPRPCRPPPAPDPPPGRTHQGAVEPLLQLSGRGHRLLGRRGLLGGRRGGARGLLGAAGRVAHGGPHPAGQAPPASEIQLSGGRGRGSRPGRGRGGSGWRWRRGSRQRGALGSAARRGRSAASHRGGPVRGTGRRAAGLGEEVRLQAAGARGLGRGQEAAALAPPSAIFELLLSLPVRANRSSPPPPPGTQPQGGGLEGGGGRWPGDPRNHGGRGVGCRAASPAAEGAAGAASPAGAGGHRGEAEAAARSAAPPGPRTASSRSPRARDWPGLGEGDHGLGIGGAHLLRTEDLSDCEHGSETHGGAALGRQGCVPVSRPGLRRWEPPSRPPTFYFSPPLLSPETS

Conservation Score

1

PhyloCSF Frame 1

5.157

No. of Spectra

3

CPC Coding Probability

0.450895

PhyloCSF Frame 2 

11.256

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0.583

CNTI Score

-0.239874832