McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA32-1:2

Chromosome

chr17

Gene Name

lnc-SPATA32-1

Start

45231048

CPC Label

noncoding

End

45241770

Cancer

OV

Strand

-

Peptide

RATPQTFTSSSPLSPQPLR

Modified Peptide

n[145]RATPQTFTSSSPLSPQPLR

Peptide Length

19

ORF Length

182

Open Reading Frame (ORF)

LRWQEPACSSPVLSDAIPNPPTPLQAPAATHTKRQGPRQRPLPRGAPTLPTQTPQIRRATPQTFTSSSPLSPQPLRCQAELLQGDPYQRLQGQLSTLFPLPSPYPWTAAQPAQAICFISRRQRPSLGSQGRLSAPNSPPPASAASLLHRIPAAAEPHPAQRWERVGPWPTAALEAGGVGTAE

Conservation Score

1

PhyloCSF Frame 1

-3.64

No. of Spectra

1

CPC Coding Probability

0.218342

PhyloCSF Frame 2 

-1.186

CNTI Index

noncoding

Max Probability

0.0687

PhyloCSF Frame 3

-3.822

CNTI Score

-0.286121436