McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA31A6-52:2

Chromosome

chr9

Gene Name

lnc-SPATA31A6-52

Start

41760090

CPC Label

noncoding

End

41761497

Cancer

PRAD

Strand

+

Peptide

LLTSSDPPASASQHAGIIDMSHHAWPNICQIEFVFPYK

Modified Peptide

LLTSSDPPASASQHAGIIDM[147]SHHAWPNICQIEFVFPYK

Peptide Length

38

ORF Length

91

Open Reading Frame (ORF)

LRWSLALLTRLEYSGTILAHCSLRLLGSSDFWLIFVFLVVTGYHHVGQAGHKLLTSSDPPASASQHAGIIDMSHHAWPNICQIEFVFPYKF

Conservation Score

0.092

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0923305

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9097

PhyloCSF Frame 3

0

CNTI Score

-0.376183398