McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA31A1-4:1

Chromosome

chr9

Gene Name

lnc-SPATA31A1-4

Start

39016968

CPC Label

noncoding

End

39039594

Cancer

OV

Strand

+

Peptide

LLALETQLTIK

Modified Peptide

n[145]LLALETQLTIK

Peptide Length

11

ORF Length

116

Open Reading Frame (ORF)

LLALETQLTIKLQCLKLYSLHTDFFSCSFLPSRRSTGARCSYSTCLWGITSTMPATLIRGLWRALCFGCQEGPRTFPIIHVHLILCLVMKDSFHLCIRWSQGIIFASWHGEAVAAF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.0867299

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9805

PhyloCSF Frame 3

0

CNTI Score

-0.357607467