McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA19-9:1

Chromosome

chr11

Gene Name

lnc-SPATA19-9

Start

133653696

CPC Label

noncoding

End

133819603

Cancer

BRCA-Basal-like

Strand

-

Peptide

AADSVLTLHR

Modified Peptide

n[145]AADSVLTLHR

Peptide Length

10

ORF Length

57

Open Reading Frame (ORF)

LRPVKCGLRPESTKKHNRTQHNKTLCCCLKAADSVLTLHRGRCFIIRFFNSPWIHSF

Conservation Score

0.027

PhyloCSF Frame 1

-5.828

No. of Spectra

3

CPC Coding Probability

0.017604

PhyloCSF Frame 2 

-3.6

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

-4.467

CNTI Score

-0.354537893