McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA17-2:1

Chromosome

chr1

Gene Name

lnc-SPATA17-2

Start

217491974

CPC Label

noncoding

End

217494283

Cancer

BRCA-Luminal B

Strand

+

Peptide

YLLNEWMNEIK

Modified Peptide

n[145]YLLNEWMNEIK

Peptide Length

11

ORF Length

52

Open Reading Frame (ORF)

MLLLISGPLLGLCNLPISSGFMHCVWSILVLSKYLLNEWMNEIKEQEVRSGI

Conservation Score

1

PhyloCSF Frame 1

-5.404

No. of Spectra

6

CPC Coding Probability

0.0246736

PhyloCSF Frame 2 

-5.348

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-3.559

CNTI Score

-0.489219463