McDonnell Genome Institute

Washington University

Transcript

lnc-SPATA16-5:1

Chromosome

chr3

Gene Name

lnc-SPATA16-5

Start

174073406

CPC Label

noncoding

End

174077277

Cancer

EOGC

Strand

-

Peptide

LMLQTFPK

Modified Peptide

n[145]LMLQTFPK

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

MLPLHWIPNKLMLQTFPKEFYSQAFQCTDTLPAYCNRLLSASVSDKPFSTFILDES

Conservation Score

0.763

PhyloCSF Frame 1

-4.861

No. of Spectra

11

CPC Coding Probability

0.0317833

PhyloCSF Frame 2 

-5.279

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-6.177

CNTI Score

-0.390818964