McDonnell Genome Institute

Washington University

Transcript

lnc-SPARCL1-1:6

Chromosome

chr4

Gene Name

lnc-SPARCL1-1

Start

87566695

CPC Label

noncoding

End

87732414

Cancer

OSCC

Strand

-

Peptide

EDQENDFK

Modified Peptide

n[145]EDQENDFK

Peptide Length

8

ORF Length

42

Open Reading Frame (ORF)

LSSFISNILETNIVIKNEAIVKEDQENDFKTISNMMILKVGH

Conservation Score

0.093

PhyloCSF Frame 1

-5.552

No. of Spectra

18

CPC Coding Probability

0.133268

PhyloCSF Frame 2 

-5.231

CNTI Index

noncoding

Max Probability

0.9398

PhyloCSF Frame 3

-5.331

CNTI Score

-0.401637157