McDonnell Genome Institute

Washington University

Transcript

lnc-SPARCL1-1:2

Chromosome

chr4

Gene Name

lnc-SPARCL1-1

Start

87568034

CPC Label

noncoding

End

87732370

Cancer

OV

Strand

-

Peptide

VSEMFVMTPWIFLTNR

Modified Peptide

n[145]VSEMFVM[147]TPWIFLTNR

Peptide Length

16

ORF Length

85

Open Reading Frame (ORF)

MNLLFLSLPGSDCTPKSVKRKVSEMFVMTPWIFLTNRASVRSVLLRSFTSNSNIQPGLKTAIHHPRMLCLGPVLLRWWAITHSEL

Conservation Score

0.45

PhyloCSF Frame 1

-5.423

No. of Spectra

7

CPC Coding Probability

0.0718557

PhyloCSF Frame 2 

-5.101

CNTI Index

noncoding

Max Probability

0.8713

PhyloCSF Frame 3

-5.319

CNTI Score

-0.416665383