McDonnell Genome Institute

Washington University

Transcript

lnc-SPANXN4-5:1

Chromosome

chrX

Gene Name

lnc-SPANXN4-5

Start

143806390

CPC Label

noncoding

End

143806733

Cancer

EOGC

Strand

+

Peptide

EIEIVDSWKVIIIFVPIPKLK

Modified Peptide

n[145]EIEIVDSWKVIIIFVPIPKLK

Peptide Length

21

ORF Length

95

Open Reading Frame (ORF)

LSPAFLELEMNSDLKPQLRELNITTTKEIEIVDSWKVIIIFVPIPKLKSFQKIQVWLLHELRRSSVGNMLSLLLRGEFCLSQLEKATQKISKSSQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.117628

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3158

PhyloCSF Frame 3

0

CNTI Score

-0.37930695