McDonnell Genome Institute

Washington University

Transcript

lnc-SPANXC-1:1

Chromosome

chrX

Gene Name

lnc-SPANXC-1

Start

141261118

CPC Label

noncoding

End

141264213

Cancer

CCRC

Strand

-

Peptide

GAQFWPLTILMGSRSK

Modified Peptide

n[230]GAQFWPLTILM[147]GSRSK

Peptide Length

16

ORF Length

114

Open Reading Frame (ORF)

LNEREVQLGVADKMSWPSEYKDSAWIFLGGLPYELTEGDIICVFSQYGRLLTSISCGTRRLGNPKDSVSSAMKARGAQFWPLTILMGSRSKEELSEWIMCLTIGLLRTQKKWIM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.236597

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6276

PhyloCSF Frame 3

0

CNTI Score

0.660193108