McDonnell Genome Institute

Washington University

Transcript

lnc-SPANXA2-1:1

Chromosome

chrX

Gene Name

lnc-SPANXA2-1

Start

141625863

CPC Label

coding

End

141626733

Cancer

BRCA-Basal-like

Strand

+

Peptide

EGETDELLK

Modified Peptide

n[145]EGETDELLK

Peptide Length

9

ORF Length

151

Open Reading Frame (ORF)

MAEFSEEEEDTVRYCCSTIEDVPEEIKEAIAYFCSKMAEINKEPEGNIGHHCYIIPKVTEEVGEASSDMPEPSTSTSQENPSMKWRKKTTCEAKEGETDELLKAAKKIRSFVQQNSERRKAGKKSTVLIFYYHSNKKRDENQPNEDEDSHE

Conservation Score

0.213

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.986767

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9963

PhyloCSF Frame 3

0

CNTI Score

-0.307343194