McDonnell Genome Institute

Washington University

Transcript

lnc-SPAG9-1:1

Chromosome

chr17

Gene Name

lnc-SPAG9-1

Start

50934988

CPC Label

noncoding

End

50944713

Cancer

OSCC

Strand

-

Peptide

LLLPAGSTTVPCGQGMESCQGLAK

Modified Peptide

n[145]LLLPAGSTTVPCGQGMESCQGLAK

Peptide Length

24

ORF Length

49

Open Reading Frame (ORF)

MLVFASLTNGCDSRGEGSGRLLLPAGSTTVPCGQGMESCQGLAKATPAL

Conservation Score

0.997

PhyloCSF Frame 1

-3.107

No. of Spectra

4

CPC Coding Probability

0.0697452

PhyloCSF Frame 2 

-3.573

CNTI Index

noncoding

Max Probability

0.8542

PhyloCSF Frame 3

-3.6

CNTI Score

-0.271866121