McDonnell Genome Institute

Washington University

Transcript

lnc-SPAG4-2:1

Chromosome

chr20

Gene Name

lnc-SPAG4-2

Start

35588323

CPC Label

noncoding

End

35588607

Cancer

OV

Strand

+

Peptide

DKTHTLCR

Modified Peptide

n[145]DKTHTLCR

Peptide Length

8

ORF Length

43

Open Reading Frame (ORF)

MTKETSSFGKHRDKTHTLCRHCGSMACQLQKSTCGKRGYPAKH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0297895

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

-0.358251603