McDonnell Genome Institute

Washington University

Transcript

lnc-SPAG1-8:1

Chromosome

chr8

Gene Name

lnc-SPAG1-8

Start

100722495

CPC Label

noncoding

End

100725485

Cancer

EOGC

Strand

+

Peptide

CLLGAGVPNGR

Modified Peptide

n[145]CLLGAGVPNGR

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

MEPAWPPALSYPDRTTSPSRHRRHARRPQKRCLLGAGVPNGRGAR

Conservation Score

1

PhyloCSF Frame 1

3.013

No. of Spectra

93

CPC Coding Probability

0.230245

PhyloCSF Frame 2 

0.146

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

1.979

CNTI Score

-0.320858947