McDonnell Genome Institute

Washington University

Transcript

lnc-SPAG1-3:7

Chromosome

chr8

Gene Name

lnc-SPAG1-3

Start

100475702

CPC Label

noncoding

End

100500565

Cancer

OV

Strand

+

Peptide

AFLHVEACQR

Modified Peptide

n[145]AFLHVEACQR

Peptide Length

10

ORF Length

37

Open Reading Frame (ORF)

LNMLIIWIAKAFLHVEACQRGCHPGATRKGSSETTPD

Conservation Score

0.046

PhyloCSF Frame 1

-5.318

No. of Spectra

15

CPC Coding Probability

0.0172567

PhyloCSF Frame 2 

-5.414

CNTI Index

noncoding

Max Probability

0.9497

PhyloCSF Frame 3

-5.681

CNTI Score

-0.387822311