McDonnell Genome Institute

Washington University

Transcript

lnc-SPACA6-5:1

Chromosome

chr19

Gene Name

lnc-SPACA6-5

Start

51648861

CPC Label

noncoding

End

51649610

Cancer

OV

Strand

+

Peptide

LATSMQLQNPNWPLSSGSEGSMVGAQR

Modified Peptide

n[145]LATSM[147]QLQNPNWPLSSGSEGSMVGAQR

Peptide Length

27

ORF Length

52

Open Reading Frame (ORF)

MQGRQEKLATSMQLQNPNWPLSSGSEGSMVGAQRSERCCSFFAIVNSPMEAL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0318171

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8447

PhyloCSF Frame 3

0

CNTI Score

-0.385418122