McDonnell Genome Institute

Washington University

Transcript

lnc-SP3-13:1

Chromosome

chr2

Gene Name

lnc-SP3-13

Start

173575109

CPC Label

noncoding

End

173576341

Cancer

BRCA-Luminal A

Strand

-

Peptide

CLELFSELAEDKK

Modified Peptide

n[145]CLELFSELAEDKK

Peptide Length

13

ORF Length

75

Open Reading Frame (ORF)

MDSCDELTQEFLNFIHGLVDSQYLPLNISREMLKQSKILKVIQTNIVKKCLELFSELAEDKKNYKKFHEAVCKNL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

50

CPC Coding Probability

0.0424296

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.320668999