McDonnell Genome Institute

Washington University

Transcript

lnc-SP3-1:1

Chromosome

chr2

Gene Name

lnc-SP3-1

Start

173880864

CPC Label

noncoding

End

173899428

Cancer

CCRC

Strand

-

Peptide

CDHSVLQPLTPGLK

Modified Peptide

CDHSVLQPLTPGLK

Peptide Length

14

ORF Length

53

Open Reading Frame (ORF)

LTGDIVSLYCPRLEQSGAIHRCDHSVLQPLTPGLKRFSASASRVVNYFFLQVG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.277773

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1754

PhyloCSF Frame 3

0

CNTI Score

-0.47567546