McDonnell Genome Institute

Washington University

Transcript

lnc-SP110-8:4

Chromosome

chr2

Gene Name

lnc-SP110-8

Start

230440434

CPC Label

noncoding

End

230513290

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

WELLVAEK

Modified Peptide

n[145]WELLVAEK

Peptide Length

8

ORF Length

35

Open Reading Frame (ORF)

LRASFENLMPHDLSLSPITPRWELLVAEKQAQGSH

Conservation Score

0.139

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.167337

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9962

PhyloCSF Frame 3

0

CNTI Score

-0.364139196