McDonnell Genome Institute

Washington University

Transcript

lnc-SOX9-7:1

Chromosome

chr17

Gene Name

lnc-SOX9-7

Start

72431127

CPC Label

noncoding

End

72592792

Cancer

OV

Strand

+

Peptide

LAEVAGGGPQAAAFSSPGVGAR

Modified Peptide

n[145]LAEVAGGGPQAAAFSSPGVGAR

Peptide Length

22

ORF Length

137

Open Reading Frame (ORF)

LRSRLAEVAGGGPQAAAFSSPGVGARRGQGPGARRTKRAHPAYSCWDITQPGRRSSPFFPAHRQRQPKIPAGKASLPSWKALKADRLSDLGLQVHKAREAYGGRLPNRGSLRRSAERQMPEAVTASSGYQRRTAHPR

Conservation Score

0.932

PhyloCSF Frame 1

-0.874

No. of Spectra

1

CPC Coding Probability

0.185937

PhyloCSF Frame 2 

-1.99

CNTI Index

noncoding

Max Probability

0.5718

PhyloCSF Frame 3

-0.663

CNTI Score

-0.29954635