McDonnell Genome Institute

Washington University

Transcript

lnc-SOX7-7:1

Chromosome

chr8

Gene Name

lnc-SOX7-7

Start

10803077

CPC Label

noncoding

End

10804810

Cancer

OV

Strand

-

Peptide

ELSFSFLLK

Modified Peptide

n[145]ELSFSFLLK

Peptide Length

9

ORF Length

41

Open Reading Frame (ORF)

MKELSFSFLLKSRHIIHYTKSYTKFTFIVNLFSTEKEYFSV

Conservation Score

0.769

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0411755

PhyloCSF Frame 2 

-4.278

CNTI Index

noncoding

Max Probability

0.4061

PhyloCSF Frame 3

-3.456

CNTI Score

-0.378770691