McDonnell Genome Institute

Washington University

Transcript

lnc-SOX5-5:1

Chromosome

chr12

Gene Name

lnc-SOX5-5

Start

24558494

CPC Label

coding

End

24563142

Cancer

PRAD

Strand

-

Peptide

QSPTLGAR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

MQSPTLGARQSRHSGWQSTVLSYKSLGICWNPLEILTYPDSQRTLSRKA

Conservation Score

1

PhyloCSF Frame 1

-2.971

No. of Spectra

1

CPC Coding Probability

0.528585

PhyloCSF Frame 2 

-2.898

CNTI Index

coding

Max Probability

0.9963

PhyloCSF Frame 3

-3.432

CNTI Score

0.659551562