McDonnell Genome Institute

Washington University

Transcript

lnc-SOX4-3:1

Chromosome

chr6

Gene Name

lnc-SOX4-3

Start

21602127

CPC Label

noncoding

End

21602383

Cancer

EOGC

Strand

+

Peptide

LVNACLAEALLRIHAFEQKTLIPEQWAR

Modified Peptide

n[145]LVNACLAEALLRIHAFEQKTLIPEQWAR

Peptide Length

28

ORF Length

49

Open Reading Frame (ORF)

LAVSAKFEGKPLLQRHRLVNACLAEALLRIHAFEQKTLIPEQWARERQK

Conservation Score

0.997

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0379161

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2586

PhyloCSF Frame 3

0

CNTI Score

-0.333314698