McDonnell Genome Institute

Washington University

Transcript

lnc-SOX30-3:2

Chromosome

chr5

Gene Name

lnc-SOX30-3

Start

157711732

CPC Label

noncoding

End

157731684

Cancer

BRCA-Luminal B

Strand

-

Peptide

LLLPPPVLR

Modified Peptide

n[145]LLLPPPVLR

Peptide Length

9

ORF Length

77

Open Reading Frame (ORF)

LLLPPPVLRQISLTRFLKIIFYLLVLTYWQKQSVSPLVPRSKSYPNLKKKKKKKILFLVFEGVAVMFPLFLVAFINL

Conservation Score

0.793

PhyloCSF Frame 1

0

No. of Spectra

88

CPC Coding Probability

0.178342

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

-0.303205313