McDonnell Genome Institute

Washington University

Transcript

lnc-SOX14-2:1

Chromosome

chr3

Gene Name

lnc-SOX14-2

Start

137791972

CPC Label

noncoding

End

137796678

Cancer

EOGC

Strand

+

Peptide

LSPSPDFLK

Modified Peptide

n[145]LSPSPDFLK

Peptide Length

9

ORF Length

47

Open Reading Frame (ORF)

LLQFQRLSPSPDFLKFSAASDTINLIHPHLLPVKILAADTHGTATWC

Conservation Score

0.156

PhyloCSF Frame 1

-3.354

No. of Spectra

180

CPC Coding Probability

0.0429391

PhyloCSF Frame 2 

-5.164

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-3.21

CNTI Score

-0.38029073