McDonnell Genome Institute

Washington University

Transcript

lnc-SOWAHD-1:1

Chromosome

chrX

Gene Name

lnc-SOWAHD-1

Start

119693567

CPC Label

noncoding

End

119696059

Cancer

OV

Strand

+

Peptide

LLPEREGTGGLRVSR

Modified Peptide

n[145]LLPEREGTGGLRVSR

Peptide Length

15

ORF Length

84

Open Reading Frame (ORF)

LAASRLGVWDRALPWQRLGRGGLKGPEVTSPDLDLGFGWWWDKRGEFGSQSRKLLPEREGTGGLRVSRENPPRTAPPALALLAD

Conservation Score

0.127

PhyloCSF Frame 1

-2.695

No. of Spectra

33

CPC Coding Probability

0.0691175

PhyloCSF Frame 2 

-3.983

CNTI Index

noncoding

Max Probability

0.66

PhyloCSF Frame 3

-3.517

CNTI Score

-0.30029456