McDonnell Genome Institute

Washington University

Transcript

lnc-SOWAHC-2:1

Chromosome

chr2

Gene Name

lnc-SOWAHC-2

Start

109667127

CPC Label

noncoding

End

109668002

Cancer

OV

Strand

+

Peptide

FLALLDALSTVCSQR

Modified Peptide

n[145]FLALLDALSTVCSQR

Peptide Length

15

ORF Length

70

Open Reading Frame (ORF)

MKGRFLALLDALSTVCSQRVQKAKKQQHLQNKEHFKALLKQKEKLKQQEDLRRSSSEFRVRGKEEARNPV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

22

CPC Coding Probability

0.183763

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9764

PhyloCSF Frame 3

0

CNTI Score

-0.325866366