McDonnell Genome Institute

Washington University

Transcript

lnc-SOWAHB-5:5

Chromosome

chr4

Gene Name

lnc-SOWAHB-5

Start

76900898

CPC Label

noncoding

End

76949565

Cancer

HCC

Strand

-

Peptide

EESLLLQILK

Modified Peptide

n[272]EESLLLQILK

Peptide Length

10

ORF Length

63

Open Reading Frame (ORF)

MEESLLLQILKLTLLLGYKVTHTNVCWSHNQQTGFRGTKHGFYSFSHCHSMVETAYNIYARYY

Conservation Score

0.943

PhyloCSF Frame 1

0

No. of Spectra

34

CPC Coding Probability

0.0881825

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0

CNTI Score

-0.285545807