McDonnell Genome Institute

Washington University

Transcript

lnc-SOWAHB-5:4

Chromosome

chr4

Gene Name

lnc-SOWAHB-5

Start

76939429

CPC Label

noncoding

End

76949615

Cancer

OV

Strand

-

Peptide

VDLFLYK

Modified Peptide

n[145]VDLFLYK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

MGMVVYRLNINKKILNCCTNIVFVISKPVRVDLFLYKLSHAIKLLLRFVECFSVSGTMQSILYASLI

Conservation Score

0.628

PhyloCSF Frame 1

-5.161

No. of Spectra

12

CPC Coding Probability

0.0504167

PhyloCSF Frame 2 

-5.231

CNTI Index

coding

Max Probability

0.7274

PhyloCSF Frame 3

0

CNTI Score

0.73117224