McDonnell Genome Institute

Washington University

Transcript

lnc-SOWAHB-5:1

Chromosome

chr4

Gene Name

lnc-SOWAHB-5

Start

76935502

CPC Label

noncoding

End

76949620

Cancer

OV

Strand

-

Peptide

SLCGPGAVAHACNPSTLGGR

Modified Peptide

n[145]SLCGPGAVAHACNPSTLGGR

Peptide Length

20

ORF Length

62

Open Reading Frame (ORF)

LRLKTISADGDLLIFFYVSVSSFFELRACISIFKIFKSLCGPGAVAHACNPSTLGGRGRRIT

Conservation Score

0.456

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.104161

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7093

PhyloCSF Frame 3

0

CNTI Score

0.73117224