McDonnell Genome Institute

Washington University

Transcript

lnc-SOS1-1:1

Chromosome

chr2

Gene Name

lnc-SOS1-1

Start

38959287

CPC Label

noncoding

End

38960344

Cancer

OSCC

Strand

-

Peptide

GSPDPPHHLR

Modified Peptide

n[145]GSPDPPHHLR

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

LSFWEMACGPGTVITPRGSPDPPHHLRCSKAHLQLSSLPCLP

Conservation Score

0.857

PhyloCSF Frame 1

-4.724

No. of Spectra

4

CPC Coding Probability

0.117998

PhyloCSF Frame 2 

-2.995

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-4.064

CNTI Score

-0.267150127